Transcript | Ll_transcript_154712 |
---|---|
CDS coordinates | 2208-2765 (+) |
Peptide sequence | MQHQIIFSPLLLLQGVGVLYAAYRLIEKIVLLLYSGDVSRTYTSIASKSRDCFGFFHHGSRLLGWWSIDERSREEEARLYCAENSGYNTFSPDTVKRMPRTDLVDEIWRLQAALGEQTEVTKYSQEQYERLQNEKILCRVCFEEQINVVLLPCRHHIICSTCSEKCKRCPVCRVMIEEPLVVYDM* |
ORF Type | complete |
Blastp | Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 36.36% of identity |
---|---|
Blastx | Kinesin-like protein KIN-7D, mitochondrial from Arabidopsis with 36.36% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT4G39050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434357.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer