| Transcript | Ll_transcript_156282 |
|---|---|
| CDS coordinates | 145-471 (+) |
| Peptide sequence | MTFGGCATAELSRFVAGSSTRNKPSQCTINSTSHRFLQLQRPIDENRLVLSVSRDRVVAKAAEGGRGLTYKDAGVDIDAGSELVRRIAKMAPGIGGFGGLFPLGMFIT* |
| ORF Type | complete |
| Blastp | Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 56.19% of identity |
|---|---|
| Blastx | Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 52.69% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414494.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer