Transcript | Ll_transcript_156288 |
---|---|
CDS coordinates | 245-844 (+) |
Peptide sequence | MFHLLKLVRFIYFQTAEMPGLYKEGEYDLSGCAVGIVKKDSLINGKNIVAGAVLIGLPSSGVHSNGFSLARRVLAQSGLSLKDQIPGGDVTIAEALMAPTVIYVKQVLDIVSKGGVKGMAHITGGGFTENIPRVFPEGLGALIYKDSWEVPTVFKWLQEVMLITSIPIAKSLFVGKLFVIFPINSLYLLIWSSNFRDNI* |
ORF Type | complete |
Blastp | Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 77.19% of identity |
---|---|
Blastx | Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 77.19% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414494.1) |
Pfam | AIR synthase related protein, C-terminal domain (PF02769.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer