Protein coding transcript 217013

• Transcript: Ll_transcript_156289
• CDS coordinates: 859-1455 (+)
• Peptide sequence: MPGLYKDGEYDLSGCAVGIVKKDSVINGKNIVPGDVLIGLPSSGVHSNGFSLVRRVLAQSGLSLKDKLPGGDVTIAEALMAPTVIYVKQVLDLVSKGGVKGMAHITGGGFTENIPRVFPEGLGALIYKDSWEIPTLFKWLQEAGKIEDAEMRRTFNMGIGMVLVVSPETSNKILEDKDNTEKFYRIGEVTSNKGMIFS*
• ORF Type: complete

Annotations of Ll_transcript_156289

• Blastp: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 83.33% of identity
• Blastx: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 69.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414494.1)
• Pfam: AIR synthase related protein, C-terminal domain (PF02769.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;