Protein coding transcript 217015

• Transcript: Ll_transcript_156270
• CDS coordinates: 1090-1905 (+)
• Peptide sequence: MLAFETGIHDTIGIDLVAMSVNDIVTSGAKPLFFLDYFATGHLDVNIAEKVIKGIVDGCQQSDCVLLGGETAEMPGLYKDGEYDLSGCAVGIVKKDSVINGKNIVPGDVLIGLPSSGVHSNGFSLVRRVLAQSGLSLKDKLPGGDVTIAEALMAPTVIYVKQVLDLVSKGGVKGMAHITGGGFTENIPRVFPEGLGALIYKDSWEIPTLFKWLQEAGKIEDAEMRRTFNMGIGMVLVVSPETSNKILEDKDNTEKFYRIGEVTSNKGMIFS*
• ORF Type: complete

Annotations of Ll_transcript_156270

• Blastp: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 85.98% of identity
• Blastx: Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic/mitochondrial from Vigna with 84.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417681.1)
• Pfam: AIR synthase related protein, N-terminal domain (PF00586.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;