Protein coding transcript 217035

• Transcript: Ll_transcript_156237
• CDS coordinates: 144-704 (+)
• Peptide sequence: MTLLTLSASIPGIKPTCHGNGDENCHANVGQSAVCFLALYLVALATGGIKPCVSSYGADQFDDADPAEKEHKSSFFNWFYFSINIGALIASSLLVWIQDNVGWGWGFGIPAVTMAIAVVSFFSGTRLYRNQKPGGSALTRICQVIVASIKKYRVQVPADKSQLYENSDTEFAIEGSRKLEHTDELR*
• ORF Type: complete

Annotations of Ll_transcript_156237

• Blastp: Protein NRT1/ PTR FAMILY 8.2 from Arabidopsis with 69.73% of identity
• Blastx: Protein NRT1/ PTR FAMILY 8.1 from Arabidopsis with 68.63% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT5G01180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429952.1)
• Pfam: POT family (PF00854.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;