Protein coding transcript 217078

• Transcript: Ll_transcript_154165
• CDS coordinates: 80-841 (+)
• Peptide sequence: MSLKCAVDLGIPDVIHNYGKPMPLSKLIASLLIHPSKTCFIYRLMRILIHSGFFSEQNVTEQNELEAEYVLTDASILLLKENPFSMTPFLHAMLDPILTKPWYHLSVWLKNDDPTPFEKTHGMTFWDYAGHDPNLNHFFNDAMASDARLVSRVLIEKYKEAFQGFESLVDVGGGTGTVTKAIASSFPKMECVVFDLPHVVTGLQGSDNLKYVGGNMFEAIPPTDAILLKWILHDWNDEECVNILKKCKEAITSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_154165

• Blastp: Trans-resveratrol di-O-methyltransferase from Vitis with 63.39% of identity
• Blastx: Trans-resveratrol di-O-methyltransferase from Vitis with 64% of identity
• Eggnog: o-methyltransferase(ENOG410XS7T)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432207.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;