Protein coding transcript 217086

• Transcript: Ll_transcript_156489
• CDS coordinates: 224-1183 (+)
• Peptide sequence: MKLDGHIEKCSSLNAVRSSVRQRRNPKGSLDLTSVQELLDEINNKCDPGMMDIVRHCTYIGMADDVFAVIQHNTHLYLANVVNLSKELIYQQVLSRFARLNAISISDPLPLKDLIILALKEEDLDSECNDVDHLQEKIAEMNSELLKQKTEIMDEFFSIYIDKHGNVATLPVILDQYTPDMDRIPEFVLCLGNDVDWEDEKNCIQGVSVALGNFYAMHPPMLPNPSGEGLLFYKKRKVLDNCTKENACDSTGSNVENDKVDHELLSEATTEWAQREWTIQHVLFPSMRLFFKPPVSMATNGTFVKVTSLERLYKTFERC*
• ORF Type: complete

Annotations of Ll_transcript_156489

• Blastp: DNA mismatch repair protein MLH1 from Arabidopsis with 66.11% of identity
• Blastx: DNA mismatch repair protein MLH1 from Arabidopsis with 65.25% of identity
• Eggnog: This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a molecular matchmaker , a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of a final effector complex (By similarity)(COG0323)
• Kegg: Link to kegg annotations (AT4G09140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441032.1)
• Pfam: DNA mismatch repair protein Mlh1 C-terminus (PF16413.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;