| Transcript | Ll_transcript_154106 |
|---|---|
| CDS coordinates | 48-440 (+) |
| Peptide sequence | MPFSFQTNVSLFEAMMGNKRWIWKQESSVKSLGETESSGSMSSYSERFSDDQEELKESPNGSNHSPEVTSKAAASEEDDNDSSIMNARFPEEVRSKPIPTKGITTNGSQEKNENGESETIKKVKEGDLNDG |
| ORF Type | 3prime_partial |
| Blastp | Filament-like plant protein 3 from Arabidopsis with 45.33% of identity |
|---|---|
| Blastx | - |
| Eggnog | filament-like plant protein(ENOG410YAAZ) |
| Kegg | Link to kegg annotations (AT3G05270) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454477.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer