| Transcript | Ll_transcript_155707 |
|---|---|
| CDS coordinates | 214-591 (+) |
| Peptide sequence | MAGSGSSMLYSILLFIVILSLQEVYRGKLASSELYTILGGFTSSLLFLVLLTFIGNFQESTGAKTGWGAVIVAEAVALIAASTVHRVCITTCFLFSAGLLYEVNKISVSALSTTESRTKKQGGRA* |
| ORF Type | complete |
| Blastp | Protein KRTCAP2 homolog from Ixodes with 37.61% of identity |
|---|---|
| Blastx | - |
| Eggnog | Keratinocyte associated protein 2(ENOG4111ZNW) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415942.1) |
| Pfam | Keratinocyte-associated protein 2 (PF09775.8) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer