Transcript | Ll_transcript_155725 |
---|---|
CDS coordinates | 549-1007 (+) |
Peptide sequence | MFMNLMIRSIYNYDIRFKKRPSDSRYGLSFDNIALNSEQDKWRNINVTAIWGSRQKAKLALKKNLPAPKIDNIHMSSSIVVYHAEEVAVTKTSAASGGTSSTSKEQIPRLDTLILESIIKLKEPKGSDRAAITAYIEDQYCSPPNLEKLLSTK |
ORF Type | 3prime_partial |
Blastp | Telomere repeat-binding factor 2 from Arabidopsis with 36.76% of identity |
---|---|
Blastx | Telomere repeat-binding factor 1 from Arabidopsis with 39.83% of identity |
Eggnog | DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3) |
Kegg | Link to kegg annotations (AT5G67580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421379.1) |
Pfam | linker histone H1 and H5 family (PF00538.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer