Protein coding transcript 217119

• Transcript: Ll_transcript_155725
• CDS coordinates: 549-1007 (+)
• Peptide sequence: MFMNLMIRSIYNYDIRFKKRPSDSRYGLSFDNIALNSEQDKWRNINVTAIWGSRQKAKLALKKNLPAPKIDNIHMSSSIVVYHAEEVAVTKTSAASGGTSSTSKEQIPRLDTLILESIIKLKEPKGSDRAAITAYIEDQYCSPPNLEKLLSTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_155725

• Blastp: Telomere repeat-binding factor 2 from Arabidopsis with 36.76% of identity
• Blastx: Telomere repeat-binding factor 1 from Arabidopsis with 39.83% of identity
• Eggnog: DNA binding double-stranded telomeric DNA binding protein homodimerization single-stranded telomeric DNA binding transcription factor(ENOG4111CH3)
• Kegg: Link to kegg annotations (AT5G67580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421379.1)
• Pfam: linker histone H1 and H5 family (PF00538.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;