Protein coding transcript 217130

• Transcript: Ll_transcript_155711
• CDS coordinates: 992-1594 (+)
• Peptide sequence: MGAPKQKWTAEEEAALKAGVVKHGAGKWRTILTDPEFSSVLRMRSNVDLKDKWRNINVTAIWGSRQKAKLALKKNLPAPKIDNIHMSSSIVVYHAEEVAVTKTSAASGGTSSTSKEQIPRLDTLILESIIKLKEPKGSDRAAITAYIEDQYCSPPNLEKLLSTKLKHMVASGKLVKVKRKYMISTNPLSSEKRRCSSSLLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_155711

• Blastp: Telomere repeat-binding factor 1 from Arabidopsis with 54.55% of identity
• Blastx: Telomere repeat-binding factor 1 from Arabidopsis with 53.57% of identity
• Eggnog: single myb histone(ENOG4111SQS)
• Kegg: Link to kegg annotations (AT1G49950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421379.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;