Protein coding transcript 217197

• Transcript: Ll_transcript_155203
• CDS coordinates: 73-735 (+)
• Peptide sequence: MATTKPKRKFPSIALCNETTSSFSSIAADLDGTLLISRSSFPYFMLVAVEAGSLLRGFVLLLSLPFVIVSYLFISEAIGIQILIFISFAGLKIRDIELASRAVLPRFYAADVRKESFEVFDRCKRKVVVTANPTVMVDPFVKDYLGGDKVLGTEIEVNPKTKKATGFVMKPGVLVGKLKRLAILKEFGEDSPDIGLGDRESDHDFMSICKVCLSCYLISK*
• ORF Type: complete

Annotations of Ll_transcript_155203

• Blastp: Glycerol-3-phosphate 2-O-acyltransferase 4 from Arabidopsis with 79.15% of identity
• Blastx: Probable glycerol-3-phosphate acyltransferase 8 from Arabidopsis with 76.99% of identity
• Eggnog: glycerol-3-phosphate acyltransferase(ENOG4111C4N)
• Kegg: Link to kegg annotations (AT1G01610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432997.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF12710.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;