Transcript | Ll_transcript_154920 |
---|---|
CDS coordinates | 27-347 (+) |
Peptide sequence | MVLNPICTYSKLNTIVKMKSICNILDGLKPVMLMVMVQVAFTVVNVLYKLAINDGMSVRVATAYRLAFGSAFTVPLALISERKNRPKLTWRVLFMAFLCGLFGYVI* |
ORF Type | complete |
Blastp | WAT1-related protein At1g25270 from Arabidopsis with 46.84% of identity |
---|---|
Blastx | WAT1-related protein At1g25270 from Arabidopsis with 46.84% of identity |
Eggnog | auxin-induced protein 5NG4-like(ENOG410YFQG) |
Kegg | Link to kegg annotations (AT1G25270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440380.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer