Protein coding transcript 217220

• Transcript: Ll_transcript_154929
• CDS coordinates: 163-522 (+)
• Peptide sequence: MKRSICNVFHGLIPAILMVMVQVALAGVSIFFKLAINVGLSVRVATAYRLTFASAFTVPLALISERDLHIRVWKLWFSVQMENPGGEVMAVGYDLSGCRGGGCWWLVFWGDGGAVGGLWA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_154929

• Blastp: WAT1-related protein At1g68170 from Arabidopsis with 50% of identity
• Blastx: WAT1-related protein At1g68170 from Arabidopsis with 50% of identity
• Eggnog: auxin-induced protein 5NG4-like(ENOG410YFQG)
• Kegg: Link to kegg annotations (AT1G68170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003531568.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;