Protein coding transcript 217227

• Transcript: Ll_transcript_154921
• CDS coordinates: 1251-1739 (+)
• Peptide sequence: MINNRRKVLSEIILLQGIVRSGLVFMVITWCVQMRGPLFASVFNPLNLVVVAVASSMLLNENLTLGSVVGAVLIVCGLYMVLWGKIREMKNITQLVPSEIIKKAEAIEVVVMTPPIINNDKCDYNNQNQTTPIKNVDKDLDYLPQNDEECDIHNKERHEVIS*
• ORF Type: complete

Annotations of Ll_transcript_154921

• Blastp: WAT1-related protein At1g68170 from Arabidopsis with 52.5% of identity
• Blastx: WAT1-related protein At1g25270 from Arabidopsis with 37.61% of identity
• Eggnog: auxin-induced protein 5NG4-like(ENOG410YFQG)
• Kegg: Link to kegg annotations (AT1G68170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424906.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;