Protein coding transcript 217258

• Transcript: Ll_transcript_154885
• CDS coordinates: 969-1598 (+)
• Peptide sequence: MYTGAENQVELVEESIQHAKEAITLDVKDGNSWYNLGNACLTSFFVNGAWDHSKLLNSLKAYQNAEKDERMSSNPDLYFNSATVHKYLENYQKALSGFEAAALKDPGLNAAEEVQKIVNLLDKVDNLLRGHVRVKRIASLASSLSAVNLNLSYKRVTINLLSEGPNRAVAVEGKVFFFIRSESIAPLYYLLCDANQTCFVLSVYGVHNDV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_154885

• Blastp: Tetratricopeptide repeat protein 5 from Homo with 36.45% of identity
• Blastx: Tetratricopeptide repeat protein 5 from Homo with 35.98% of identity
• Eggnog: tetratricopeptide repeat domain 5(ENOG410XP1F)
• Kegg: Link to kegg annotations (91875)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453516.1)
• Pfam: Tetratricopeptide repeat protein 5 OB fold domain (PF16669.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;