Protein coding transcript 217263

• Transcript: Ll_transcript_154875
• CDS coordinates: 2-556 (+)
• Peptide sequence: MNMAEEEEEALTKATREVEDLYHIRDTYFPPEPIDRISKLQHHSDLALQLLDSVPLEQRKSPMQRATFEYLRGKILDVFPDYRKEAEDHLSKAVKLNPSLADAWLCLGNCIWKKGDLSATKNCLSLALNKGPNKKILCQLSMLKRKMSQGAENQVELVEESIQHAKEAITLDVKDGNSWCTFVK*
• ORF Type: complete

Annotations of Ll_transcript_154875

• Blastp: Tetratricopeptide repeat protein 5 from Homo with 39.46% of identity
• Blastx: Tetratricopeptide repeat protein 5 from Homo with 36.56% of identity
• Eggnog: tetratricopeptide repeat domain 5(ENOG410XP1F)
• Kegg: Link to kegg annotations (91875)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453516.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;