Protein coding transcript 217359

• Transcript: Ll_transcript_154902
• CDS coordinates: 1107-1862 (+)
• Peptide sequence: MAEKDPFAPHGLRLTIEDYPYANDGLLLWDTIKLWVTDYVNHYYPEPSLVALDEELQAWWTEIRTVGHADKKDEPWWPVLQTPKDLIGILNIIIWVTSGYHAAVNFGQYAYGGYFPNRPTIARTKLPSEDPTEEEWKKFIAKPEKTLLKCFPSQLQATTVMAVLDILSTHSPDEEYIGEKMEPSWSEDPVIKDAFEQFRDRLKKLEGLIDARNENANLKNRNGAGIMPYELLKPFSKPGVTGMGVPCSISI*
• ORF Type: complete

Annotations of Ll_transcript_154902

• Blastp: Linoleate 13S-lipoxygenase 2-1, chloroplastic from Solanum with 70.92% of identity
• Blastx: Linoleate 13S-lipoxygenase 2-1, chloroplastic from Solanum with 70.31% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410YN4N)
• Kegg: Link to kegg annotations (102596122)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413925.1)
• Pfam: Lipoxygenase (PF00305.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;