Protein coding transcript 217367

• Transcript: Ll_transcript_154212
• CDS coordinates: 184-810 (+)
• Peptide sequence: MELQQNEFDRLFFFEHARKTAEAEYAINPLDADNLTRWGGALLELSQFQGLPESKKMTQEAVSKLEEALAINPKKHDTLWCLGNAYTSQAFLIPDQEEAKPYFDKAAEYFQQAVDEDSTNELYQKSLEVAAKAPELHVEIHKHGFGQQQQAAAPAGPSTSSGTKTQKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSNIPPPPPPPLR*
• ORF Type: complete

Annotations of Ll_transcript_154212

• Blastp: Mitochondrial import receptor subunit TOM20 from Solanum with 72.86% of identity
• Blastx: Mitochondrial import receptor subunit TOM20 from Solanum with 71.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102603648)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428099.1)
• Pfam: Plant specific mitochondrial import receptor subunit TOM20 (PF06552.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;