Transcript | Ll_transcript_154215 |
---|---|
CDS coordinates | 495-2414 (+) |
Peptide sequence | MDKKLSLLFILSAVFMMGLMVLGVGAEPVEDKQALLDFLHNMHHDSSHLNWDANSSVCQNWRGVTCNTEQSRVIALRLPGAGLSGPIPNNTLSLLSGLQLLSLRSNGISGPFSSGFSQLKNLTTIYLQFNKLSGPLPLDFSVWNNLTIINLSNNSFNGSIPFSISNLTHLTSLVLANNSLSGEIPDLNIPSLQELNLANNNLSGVVPKPLLKFPSSVFAGNNLTFATALAPALPVQPPNAQPPKKTRGISEPALLGIIIGGCILAFLVVAVFMIASWYGKEDADPKPVKSQKKKEVSMKKEAFENKKSQDKNKIVFFEDCYLAFDLEDLLRSSAEILGKGTFGMTYKAALDDVTTVVVKRLKEVTVGKREFEQHMEVVGKIKHDNVDALKAYFYSKEEKLIVYEYYHQGSISAMLHGRSGEGRSSLDWDSRLRIAIGAARGIAHIHAQLGGKLVHGNIKASNIFLNSEGYGCISDIGLATLMNPISPSAMRFAGYRAPEIIDNRKATHASDVYSFGVLLLELLTGKSPVHTRNEDVVPLVRWVNSVVREEWTAEVFDVQLLRYPNIEEEMVEMLQLGLACAARVPDQRPKIQDVVIRVEEIRRVNTGNRPSSECRSEVSTPTPQPHLMQIEITSTSVPQ* |
ORF Type | complete |
Blastp | Probable inactive receptor kinase At4g23740 from Arabidopsis with 53.59% of identity |
---|---|
Blastx | Probable inactive receptor kinase At4g23740 from Arabidopsis with 53.06% of identity |
Eggnog | Leucine rich repeat N-terminal domain(ENOG410YDXU) |
Kegg | Link to kegg annotations (AT4G23740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438638.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer