Protein coding transcript 217424

• Transcript: Ll_transcript_154135
• CDS coordinates: 2068-2847 (+)
• Peptide sequence: MSFGIGKSLQLLRVLNLRGNYLREDDAESLVYAMAHMPILEDLDISDNFIGDEGIRNLIPLFDGTSGMCSHLVCLKVETCELSYVGVGHLLDALSNFKGPLKSLSVADNYLGSQVAEALAKFLSTPIEVLDIAGIGLGSSGFQELQNVVKDDLKLVKIDMSKNRGGIETAKFLSTLLPKAPQLVDVNAASNLMPIESLDIISCALKLAKGNVEHLDLSGHTWNYKPEHASLHTEFVNDGKPILILPSPSLFAAPYDDDP*
• ORF Type: complete

Annotations of Ll_transcript_154135

• Blastp: Tonsoku-like protein from Mus with 27.53% of identity
• Blastx: NLR family CARD domain-containing protein 3 from Homo with 24.15% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (72749)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456999.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;