Protein coding transcript 217436

• Transcript: Ll_transcript_154146
• CDS coordinates: 2630-3310 (+)
• Peptide sequence: MAHMPILEDLDISDNFIGDEGIRNLIPLFDGTSGMCSHLVCLKVETCELSYVGVGHLLDALSNFKGPLKSLSVADNYLGSQVAEALAKFLSTPIEVLDIAGIGLGSSGFQELQNVVKDDLKLVKIDMSKNRGGIETAKFLSTLLPKAPQLVDVNAASNLMPIESLDIISCALKLAKGNVEHLDLSGHTWNYKPEHASLHTEFVNDGKPILILPSPSLFAAPYDDDP*
• ORF Type: complete

Annotations of Ll_transcript_154146

• Blastp: Ribonuclease inhibitor from Sus with 29.1% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (445517)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456999.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;