Protein coding transcript 217567

• Transcript: Ll_transcript_155680
• CDS coordinates: 1615-1947 (+)
• Peptide sequence: MLTLSTDRFQRIQKEAPPEYQSYLVQVTKYQAAKNCKTWIVGKWITPREQRWAPSGTHFHQFVVPPIFPFRRDCTYGDLAAMRLPQDVEGLGCCEVRNHQYIFIINYFIS*
• ORF Type: complete

Annotations of Ll_transcript_155680

• Blastp: Protein ECERIFERUM 3 from Arabidopsis with 80% of identity
• Blastx: Protein ECERIFERUM 3 from Arabidopsis with 80% of identity
• Eggnog: WAX2 C-terminal domain(ENOG410Y1F6)
• Kegg: Link to kegg annotations (AT5G57800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449230.1)
• Pfam: WAX2 C-terminal domain (PF12076.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;