Protein coding transcript 217580

• Transcript: Ll_transcript_155671
• CDS coordinates: 515-1630 (+)
• Peptide sequence: MGAPLSTWPWENFGIFKYMLYAPFVAKVLYERFYVEDSNLSFNWCLHLLILFGLRGLLHLLWNCYSNMLFLTRNRRILQPGVDFKQIDKEWDWDNFLILQALIASMVYYMFPFLQNLPLWNFKGLICALILHVGISEPLYYWGHRKFHGDYLFTHYHSLHHSSPVPQSLTVGNSTVLEALIMTALIGIPVLGVSVMGYGSATLIYGYILGFDFLRCLGHCNVEIVPHRLFEIFPFMRYLIYTATYHTLHHTDKDTNFCLFMPLFDALGNTVNSKSWQLHKTLSLGRPSRVPDFVFLAHIVDITSCMHVQFCLRSFSSLPFRTRFFLIPFWPIALISLLAMWIWSKTFLVSFYYLRGRLHQTWAVPRFGFQV*
• ORF Type: complete

Annotations of Ll_transcript_155671

• Blastp: Protein ECERIFERUM 3 from Arabidopsis with 58.62% of identity
• Blastx: Protein ECERIFERUM 3 from Arabidopsis with 58.62% of identity
• Eggnog: WAX2 C-terminal domain(ENOG410Y1F6)
• Kegg: Link to kegg annotations (AT5G57800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449230.1)
• Pfam: Fatty acid hydroxylase superfamily (PF04116.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;