Transcript | Ll_transcript_534188 |
---|---|
CDS coordinates | 2-343 (+) |
Peptide sequence | SDITAVDYPTKDQRFEVVYNMLSVRHNSRIRVKTYADEASPVPSITCLYDGANWYEREVYDMFGVFFVGHPDLRRIMTDYGFDGHPLRKDFPMTGYTEIRYDEEKKRIVVEPLE |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial from Neurospora with 93.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU04074) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (YP_009237617.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer