Transcript | Ll_transcript_154616 |
---|---|
CDS coordinates | 788-1360 (+) |
Peptide sequence | MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIISVHAEQSSTIHLHRTVNQVKSLGAKAGVVLNPGTPLSAIEYVLDVLDLVLIMSVNPGFGGQSFIESQVKKISDLRRLCVEKGVNPWIEVDGGVTPQNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSKRPEPVAV* |
ORF Type | complete |
Blastp | Ribulose-phosphate 3-epimerase, chloroplastic from Spinacia with 94.21% of identity |
---|---|
Blastx | Ribulose-phosphate 3-epimerase, chloroplastic from Spinacia with 94.69% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438542.1) |
Pfam | Ribulose-phosphate 3 epimerase family (PF00834.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer