Protein coding transcript 217651

• Transcript: Ll_transcript_154612
• CDS coordinates: 261-758 (+)
• Peptide sequence: MSATSLCSSTLQSQINGINNHLQKNSPFQPRSLTFSRRKLSTVVKASSRVDKFSKSDIIVSPSILSANFSKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIISVHAEQSSTIHLHRTVNQVRFPS*
• ORF Type: complete

Annotations of Ll_transcript_154612

• Blastp: Ribulose-phosphate 3-epimerase, chloroplastic from Spinacia with 82.53% of identity
• Blastx: Ribulose-phosphate 3-epimerase, chloroplastic from Spinacia with 82.53% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438542.1)
• Pfam: Ribulose-phosphate 3 epimerase family (PF00834.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;