Transcript | Ll_transcript_156315 |
---|---|
CDS coordinates | 141-860 (+) |
Peptide sequence | MGKKSLKLPSLFKPKEEPPKKQHRSWHFLPSCGHSKTLSFRAGDNIFKTVNSVFFEPSSETTIETPESWFTTSSESASFSTESEEYCNYDGESLEMLVRGVRSERLFFEPGDTSSILEKSKVIGFPFKESVVLAMESDDPYEDFKRSMVEMVESRGVNSWESLEELLSWYLRVNGKNNHGFIVGAFVDLLVSMVASNSCSESTTYSSAVSSFSSSSPLCLSKSQNEIIELEPEEDTATS* |
ORF Type | complete |
Blastp | Transcription repressor OFP13 from Arabidopsis with 51.32% of identity |
---|---|
Blastx | Transcription repressor OFP13 from Arabidopsis with 49.47% of identity |
Eggnog | atofp18 ofp18(ENOG410YHQG) |
Kegg | Link to kegg annotations (AT5G04820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441364.1) |
Pfam | Transcriptional repressor, ovate (PF04844.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer