Protein coding transcript 217770

• Transcript: Ll_transcript_156315
• CDS coordinates: 141-860 (+)
• Peptide sequence: MGKKSLKLPSLFKPKEEPPKKQHRSWHFLPSCGHSKTLSFRAGDNIFKTVNSVFFEPSSETTIETPESWFTTSSESASFSTESEEYCNYDGESLEMLVRGVRSERLFFEPGDTSSILEKSKVIGFPFKESVVLAMESDDPYEDFKRSMVEMVESRGVNSWESLEELLSWYLRVNGKNNHGFIVGAFVDLLVSMVASNSCSESTTYSSAVSSFSSSSPLCLSKSQNEIIELEPEEDTATS*
• ORF Type: complete

Annotations of Ll_transcript_156315

• Blastp: Transcription repressor OFP13 from Arabidopsis with 51.32% of identity
• Blastx: Transcription repressor OFP13 from Arabidopsis with 49.47% of identity
• Eggnog: atofp18 ofp18(ENOG410YHQG)
• Kegg: Link to kegg annotations (AT5G04820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441364.1)
• Pfam: Transcriptional repressor, ovate (PF04844.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;