Protein coding transcript 217785

• Transcript: Ll_transcript_156320
• CDS coordinates: 300-881 (+)
• Peptide sequence: MLSFSIYFPSVTASSSPLFSLEVIKPKDNVASHCQLFPAKMAPTVYSRTFLDAKNEQELLSGIEKEVKAGSLPPNVAAGMEELYKNYKNAVFQSGDPKANETVLSNMTVFLDLIFLDVTDPFVFQPHHKAKRKPFDYYMFGQNYIRPLVDYRSSYVGNMPLFIEIEEKLKKVPISNIFSLYCKVTCIFAVKYW*
• ORF Type: complete

Annotations of Ll_transcript_156320

• Blastp: Glycerol-3-phosphate acyltransferase, chloroplastic from Phaseolus with 67.95% of identity
• Blastx: Glycerol-3-phosphate acyltransferase, chloroplastic from Phaseolus with 67.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423896.1)
• Pfam: Glycerol-3-phosphate acyltransferase N-terminal (PF14829.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;