Protein coding transcript 217921

• Transcript: Ll_transcript_83572
• CDS coordinates: 706-1128 (+)
• Peptide sequence: MLLRNIDHNDGLCNGTKMIVNRLATHVIEARVMTGKNIRKIFYIPRMSLSPSHSPWPFKLTRRQFPLMVSYAMTINKSQGQSLASVGLYLPKLVFSHGQLYVAFSRVQSMEGLKVLIHDKEGKSINTTINVVFKEVFQNL*
• ORF Type: complete

Annotations of Ll_transcript_83572

• Blastp: ATP-dependent DNA helicase PIF1 from Xenopus with 34.4% of identity
• Blastx: ATP-dependent DNA helicase PIF1 from Xenopus with 27.33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (734585)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014620840.1)
• Pfam: Helicase (PF02689.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;