Protein coding transcript 217975

• Transcript: Ll_transcript_83884
• CDS coordinates: 1489-1851 (+)
• Peptide sequence: MDNSPTTGSVNTTTVEKQHLAKSSLAFNCKNATFRKMFPEYVEKYKEQQLASERISLEMSIDESTRPAPEKVLDLMDDVNRVNELKDVRRNKRQPSPTWMVFLLVCIFGVVMALPLLQLL*
• ORF Type: complete

Annotations of Ll_transcript_83884

• Blastp: Probable ubiquitin-conjugating enzyme E2 33 from Arabidopsis with 54.69% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 90.6% of identity
• Eggnog: Ubiquitin-conjugating enzyme E2(ENOG410Z0AN)
• Kegg: Link to kegg annotations (AT5G50430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423599.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;