Transcript | Ll_transcript_83890 |
---|---|
CDS coordinates | 419-1039 (+) |
Peptide sequence | MAEKLCIKRLQKEYRALCKDPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKFPPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDNSPTTGSVNTTTAEKQRLAKSSLSFNCKNATFRKMFPEYVEKYNQQQLSEQVASEKVLSEASRDKSSSPVVEKNLNSTREDMKKVDGLKE |
ORF Type | 3prime_partial |
Blastp | Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 79.23% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2 34 from Arabidopsis with 79.23% of identity |
Eggnog | Ubiquitin-conjugating enzyme E2(ENOG410Z0AN) |
Kegg | Link to kegg annotations (AT1G17280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430306.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer