Protein coding transcript 218011

• Transcript: Ll_transcript_84936
• CDS coordinates: 2-664 (+)
• Peptide sequence: WNSHFTLSNCNAAVQISFSTHPYFIGKSVPNYPHSQTLLFLLSFSSIHTSTWHNLHHYVLNHFPSFNGMGASLSTASTTASATAGPTLGDIPESCVAGVLPHLTPPEICNLARLNRAFRGAASSNSVWESKLPCNYQQLLDIIMPPHQRYQNLSMKDIFALLSRPLPFHDGNKVSFHCNSFLISYSKHINVVSKVLTIETQFSHFGTEMQIGFLVGSFVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_84936

• Blastp: F-box protein PP2-A15 from Arabidopsis with 66.98% of identity
• Blastx: F-box protein PP2-A15 from Arabidopsis with 73.03% of identity
• Eggnog: F-box protein(ENOG410YE99)
• Kegg: Link to kegg annotations (AT3G53000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456732.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;