Protein coding transcript 218075

• Transcript: Ll_transcript_84601
• CDS coordinates: 1-741 (+)
• Peptide sequence: PEAEGLMMMMMGGGGGGGGDSALVRVVAQSLKPDLSLENGWPQFGKFDVGLVGSSLLPHVSAFEDNSAISRTCSRDMASPMEKKETFKKRKGEKDQNSKVVEEKDNKDKKIKVSYGEEESKMTEQTSRKNTKPNTSKNKESVGGDSSKENSKESEAENPKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCSKITGKAGMLDEIINYVQSLQRQVEVSFGSLHSLPLTLLYKKLG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_84601

• Blastp: Transcription factor HBI1 from Arabidopsis with 48.77% of identity
• Blastx: Transcription factor bHLH63 from Arabidopsis with 66.07% of identity
• Eggnog: basic helix-loop-helix (bHLH) family protein(ENOG411190E)
• Kegg: Link to kegg annotations (AT2G18300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451429.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;