Protein coding transcript 218076

• Transcript: Ll_transcript_84605
• CDS coordinates: 273-1016 (+)
• Peptide sequence: MTEQTSRKNTKPNTSKNKESVGGDSSKENSKESEAENPKPDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCSKITGKAGMLDEIINYVQSLQRQVEFLSMKLAVVNPRLDFNIDDLFAKEVFHACSPSFPNIEMQSDMTINPAYLQFNPAQLVSYRGGLINNPSDMELRRTTTAPVYLPETFIDASSCFTQILPSSTWEGDFQNLYNNVAFDQARTPSFPSQPLSGVVDNSNIKMEM*
• ORF Type: complete

Annotations of Ll_transcript_84605

• Blastp: Transcription factor bHLH63 from Arabidopsis with 53.81% of identity
• Blastx: Transcription factor bHLH63 from Arabidopsis with 49.16% of identity
• Eggnog: Transcription factor(ENOG410YGAM)
• Kegg: Link to kegg annotations (AT4G34530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451429.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;