Transcript | Ll_transcript_85995 |
---|---|
CDS coordinates | 73-405 (-) |
Peptide sequence | MCKRGLNKRCRKQKLLSNLQLSILGRKKGLLGWLRCQEPPKFKHKRVPEASGSPHVPVMHSLPMTRLFMKAHPTCLLTLGAQTHELHHLTIPQHTDLVLVDVQQSQVVVH* |
ORF Type | complete |
Blastp | SNW/SKI-interacting protein from Arabidopsis with 84.62% of identity |
---|---|
Blastx | Protein TOPLESS from Arabidopsis with 84.38% of identity |
Eggnog | SNW domain containing 1(ENOG410XQGT) |
Kegg | Link to kegg annotations (AT1G77180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457960.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer