Protein coding transcript 218103

• Transcript: Ll_transcript_86005
• CDS coordinates: 305-622 (-)
• Peptide sequence: MVQSISSTNILSNLQLSILGRKKGLLGWLRCQEPPKFKHKRVPEASGSPHVPVMHSLPMTRLFMKAHPTCLLTLGAQTHELHHLTIPQHTDLVLVDVQQSQVVVH*
• ORF Type: complete

Annotations of Ll_transcript_86005

• Blastp: SNW/SKI-interacting protein from Arabidopsis with 84.62% of identity
• Blastx: SNW/SKI-interacting protein from Arabidopsis with 62.32% of identity
• Eggnog: SNW domain containing 1(ENOG410XQGT)
• Kegg: Link to kegg annotations (AT1G77180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458141.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;