| Transcript | Ll_transcript_86006 |
|---|---|
| CDS coordinates | 663-995 (-) |
| Peptide sequence | MCKRGLNKRCRKQKLLSNLQLSILGRKKGLLGWLRCQEPPKFKHKRVPEASGSPHVPVMHSLPMTRLFMKAHPTCLLTLGAQTHELHHLTIPQHTDLVLVDVQQSQVVVH* |
| ORF Type | complete |
| Blastp | SNW/SKI-interacting protein from Arabidopsis with 84.62% of identity |
|---|---|
| Blastx | Protein TOPLESS from Arabidopsis with 86.36% of identity |
| Eggnog | SNW domain containing 1(ENOG410XQGT) |
| Kegg | Link to kegg annotations (AT1G77180) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457961.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer