Protein coding transcript 218297

• Transcript: Ll_transcript_85233
• CDS coordinates: 35-1111 (+)
• Peptide sequence: MSYIGVTVAALCCVVVVFGGLTLSSDAQLDTSFYKKSCPKVHSIVREVVRNVSKKDPRMLASLIRLHFHDCFVLGCDASVLLNNTDTPTKIESEQEAFPNINSLRGLDVVNQIKTAVENACPGVVSCADILTLAAEISSVLGGGPDWKVPLGRRDGVTANRTLANINLPSPFSNLDQLKDRFTAQGLNTNDLVALSGAHTFGRARCTFITNRLYNFSNSGQPDPTLDTSYLQQLRGECPNGGNGNNLVNFDLTTPNTIDNNYYSNLQVKKGLLQSDQELFSTTGADTISLVNTFASNQDAFFASFKASMIKMGNIGVITGNNGEIRKQCNFINKKSAELDLASVASKESSQEGMVSSF*
• ORF Type: complete

Annotations of Ll_transcript_85233

• Blastp: Peroxidase 15 from Ipomoea with 60.62% of identity
• Blastx: Peroxidase 15 from Ipomoea with 62.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419105.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;