Protein coding transcript 218298

• Transcript: Ll_transcript_85235
• CDS coordinates: 1-516 (+)
• Peptide sequence: LKSAFAAQGLNTTDLVALSGAHTFGRARCTFVTSRLYNFNNSSKPDPTLDTTYLQQLRGQCPNGGPGNNLVNFDVTSPDTIDNDYYSNLKVKKGLLQSDQELFSTSGADTISLVNTFASNQDVFFANFKASMIKMGNIGVITGKNGEIRKQCNFINKKSVELDLASVVPKE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_85235

• Blastp: Peroxidase C3 from Armoracia with 61.64% of identity
• Blastx: Peroxidase C3 from Armoracia with 61.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426077.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;