Protein coding transcript 2183

• Transcript: Ll_transcript_534215
• CDS coordinates: 2-547 (+)
• Peptide sequence: CPRAMKQLLDEQDSIRSDSREEGLTWQDYKAMPFTQCVIDETLRLGGIAIWLMREAKQDIQYQDFVIPKGCFVVPFLSAVHLDENVYNAAQSFNPWRWMEPENEEKRNWRTSPFYAPFGGGARFCPGAELARLQIALFLHYFVTTYRWTQIKEDKMSFFPCARLVNGFEIRLTRRQDHETK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_534215

• Blastp: Abietadienol/abietadienal oxidase from Pinus with 46.89% of identity
• Blastx: Abietadienol/abietadienal oxidase from Pinus with 46.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAX07431)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457455.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;