| Transcript | Ll_transcript_85246 |
|---|---|
| CDS coordinates | 90-395 (+) |
| Peptide sequence | MGLIPVTIIAGLCYAVVVLVGFPLSSNAELDPSFYKNTCSNVSSIVREVVRDVSKKDPRMLASLIRLHFHDCFVLGCDASILLNNTDTPTKIESEQQAFPNN |
| ORF Type | 3prime_partial |
| Blastp | Peroxidase C1A from Armoracia with 56.58% of identity |
|---|---|
| Blastx | Peroxidase C1C from Armoracia with 56.58% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431263.1) |
| Pfam | Peroxidase (PF00141.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer