Protein coding transcript 218315

• Transcript: Ll_transcript_85227
• CDS coordinates: 1555-1980 (+)
• Peptide sequence: MYVGPALLIDVPKDKNITAEVMKSLNIPRGVNRVLFRTLNTDRRLMFKKDWDTSYVGFMEDGAKWLVENTDIKLVGIDYLSVAAYDDLIPSHLVFLKDREIILVEALKLDDVPAGTYSVHCLPLRLAGAEGSPIRCILIKI*
• ORF Type: complete

Annotations of Ll_transcript_85227

• Blastp: Kynurenine formamidase from Bacillus cereus group with 34.29% of identity
• Blastx: Kynurenine formamidase from Bacillus cereus group with 34.29% of identity
• Eggnog: Cyclase family(COG1878)
• Kegg: Link to kegg annotations (BC2758)
• CantataDB: Link to cantataDB annotations (CNT0002769)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453041.1)
• Pfam: Putative cyclase (PF04199.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;