Protein coding transcript 218363

• Transcript: Ll_transcript_84234
• CDS coordinates: 3137-4126 (+)
• Peptide sequence: MAPTKEEEIKLKNYDGDLSKLGSAERFLKAVLDIPFAFKRVETMLYRANFDAEVNHLKKSFQALEAASVELRNSPLLFKLLEAVLRTGNRMNVGTNRGDAKAFKLDTLLKLVDIKGTDGKTTLLHFVVQEIIRSEGADEESANENVKSQMDSKFNEDEFKKQGLHVVAGLSRDLSNVKKAAGMDSDVLSSYLSKLETGLDKLRLVLQYEKPDVQGNFFKSTKLFLRDAEDEIARIKADERKALFLVKEVTEYFHGDTAKEEAHPLRIFMIVRDFLNILDLVCKEVGRMHDRIVGGSSRSFRIAAAASLPVLNRYNARQDRSSDEESSSP*
• ORF Type: complete

Annotations of Ll_transcript_84234

• Blastp: Formin-like protein 6 from Arabidopsis with 70.19% of identity
• Blastx: Formin-like protein 6 from Arabidopsis with 71.04% of identity
• Eggnog: inverted formin, FH2 and WH2 domain containing(ENOG410XQR0)
• Kegg: Link to kegg annotations (AT5G67470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421023.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;