Protein coding transcript 218569

• Transcript: Ll_transcript_83524
• CDS coordinates: 3-299 (+)
• Peptide sequence: TLQLVGGVLKNVTNLSLKRIKGVVELWGPNGTQPSKVDYKEEMAKIRRIIVDFHGEMVLLVNYSNINYTGLAKILKKYDKRTGGLLRLPFIQKVLEQPF
• ORF Type: internal

Annotations of Ll_transcript_83524

• Blastp: SPX domain-containing protein 1 from Arabidopsis with 79.03% of identity
• Blastx: SPX domain-containing protein 1 from Arabidopsis with 79.03% of identity
• Eggnog: Vacuolar transporter chaperone(COG5036)
• Kegg: Link to kegg annotations (AT5G20150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446998.1)
• Pfam: SPX domain (PF03105.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;