Protein coding transcript 218576

• Transcript: Ll_transcript_83518
• CDS coordinates: 3-437 (+)
• Peptide sequence: EIWEEIEKTDSGVVPEWRDNYLSYKEMKKLVKLISGSPMFMNGSLEYGKGEAEFVYLLNNEIEKFNGFFMEKEEDFIILHEELQQRIKGVVELWGPNGTQPSKVDYKEEMGKIRRAIVDFHGEMVLLVHYSNINYTGISFLPFT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_83518

• Blastp: SPX domain-containing protein 3 from Arabidopsis with 49.28% of identity
• Blastx: SPX domain-containing protein 3 from Arabidopsis with 49.28% of identity
• Eggnog: SPX domain gene(ENOG410XU76)
• Kegg: Link to kegg annotations (AT2G45130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446998.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;