Protein coding transcript 218582

• Transcript: Ll_transcript_83519
• CDS coordinates: 1-543 (+)
• Peptide sequence: YFSCPHSHDSFVIEKIELIFYFGSIIVTEKMKFGKSLSNQIEKTLPQWRDKFLSYKELKKKLKLVEPASKGSDEERSAKRVRVDGEKMLKEEIDFRKSLENEVYKFNTFFVEKEEECIIRFKELRDMVAKVKDSNEEMMKIRKEIVDFHGEMVLLENYSALNYTGSSNFHNIICRSLTKT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_83519

• Blastp: SPX domain-containing protein 1 from Arabidopsis with 70.8% of identity
• Blastx: SPX domain-containing protein 2 from Arabidopsis with 66.45% of identity
• Eggnog: Vacuolar transporter chaperone(COG5036)
• Kegg: Link to kegg annotations (AT5G20150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017442764.1)
• Pfam: SPX domain (PF03105.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;