Protein coding transcript 218652

• Transcript: Ll_transcript_85627
• CDS coordinates: 3-380 (+)
• Peptide sequence: KFKGKPLVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDEGNKVRKEWGVPGDFFGALPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQIR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_85627

• Blastp: Peroxiredoxin Q, chloroplastic from Sedum with 94.31% of identity
• Blastx: Peroxiredoxin Q, chloroplastic from Sedum with 94.31% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443546.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;