Transcript | Ll_transcript_85941 |
---|---|
CDS coordinates | 334-1383 (+) |
Peptide sequence | MLQCIFLVSDSGEVMLEKQLTGHRVDRSICAWFWDQAISQGDSFKQQPVIASPTHYLFQVVREGITFLACTQVEMPPLMAIEFLCRVADVLNDYLGGLNEDLIKDNFVIVYELLDEMIDNGFPLTTEPNILQEMIAPPNLVSKVLSVVTGSSSNVSDTLPGATASCVPWRTADPKYANNEIYVDLAEEMDATINRDGFLVKCEIYGEVQVNSHITGLPDLTLSFANPSILDSVRFHPCVRFRPWESNQILSFVPPDGQFKLMSYRVRNLKNTPIYVKPQLTSDAGTCRVSVLVGIKNDPGKTIDAVTVQFQLPSCIVSADLTSNHGTVNILSNKVPNKQQYFCSFLSRK* |
ORF Type | complete |
Blastp | AP-3 complex subunit mu from Arabidopsis with 82.93% of identity |
---|---|
Blastx | AP-3 complex subunit mu from Arabidopsis with 74.51% of identity |
Eggnog | adaptor-related protein complex 3, mu(ENOG410XT7B) |
Kegg | Link to kegg annotations (AT1G56590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422491.1) |
Pfam | Adaptor complexes medium subunit family (PF00928.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer